PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.10273s0259.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 205aa    MW: 23117 Da    PI: 8.9952
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.10273s0259.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.55.5e-1965120156
                           TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           rrk+ ++tkeq + Lee F +n++++ +++++LA+ l+L++rqV vWFqNrRa+ k
  Bostr.10273s0259.1.p  65 RRKKLRLTKEQSHLLEESFIQNHTLTLKQKKDLATFLKLSQRQVEVWFQNRRARSK 120
                           79999*************************************************98 PP

2HD-ZIP_I/II105.34.7e-3466154190
           HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                           +kk+rl+keq++lLEesF ++++L+ ++K++la+ L+l++rqv+vWFqnrRAR k+k++E+++e+Lkr++ +lke+n+rL+ eveeLr 
  Bostr.10273s0259.1.p  66 RKKLRLTKEQSHLLEESFIQNHTLTLKQKKDLATFLKLSQRQVEVWFQNRRARSKLKHTEMECEYLKRWFGSLKEQNRRLQIEVEELR- 153
                           69*************************************************************************************9. PP

           HD-ZIP_I/II  90 e 90 
                           +
  Bostr.10273s0259.1.p 154 A 154
                           4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-1845120IPR009057Homeodomain-like
SuperFamilySSF466895.01E-1952121IPR009057Homeodomain-like
PROSITE profilePS5007117.7562122IPR001356Homeobox domain
SMARTSM003891.1E-1664126IPR001356Homeobox domain
PfamPF000462.8E-1665120IPR001356Homeobox domain
CDDcd000863.88E-1565123No hitNo description
PROSITE patternPS00027097120IPR017970Homeobox, conserved site
SMARTSM003402.9E-16122165IPR003106Leucine zipper, homeobox-associated
PfamPF021832.9E-9122156IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MAISPNSSSL ELTISIPSFS PSPSPGDHHG MRDFDINQTP KTEEDHMIGA TQHVNEEDSN  60
SAGRRRKKLR LTKEQSHLLE ESFIQNHTLT LKQKKDLATF LKLSQRQVEV WFQNRRARSK  120
LKHTEMECEY LKRWFGSLKE QNRRLQIEVE ELRALKPSST SALTMCPRCE RVTGAADSDS  180
NAVQEGAALS SRSRMTISSS SSLC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16270GRRRKKLRL
26369RRRKKLR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00226DAPTransfer from AT1G70920Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1758370.0AK175837.1 Arabidopsis thaliana mRNA, complete cds, clone: RAFL22-44-P21.
GenBankAK1759650.0AK175965.1 Arabidopsis thaliana mRNA, complete cds, clone: RAFL22-65-O17.
GenBankEU3391860.0EU339186.1 Arabidopsis thaliana HD-ZIP transcription factor 18 (ATHB18) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010415789.11e-119PREDICTED: homeobox-leucine zipper protein ATHB-X isoform X2
SwissprotQ8GXM71e-119ATHBX_ARATH; Homeobox-leucine zipper protein ATHB-X
TrEMBLA9Z1E81e-117A9Z1E8_ARATH; HD-ZIP transcription factor 18
STRINGAT1G70920.11e-117(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM133801624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70920.11e-119homeobox-leucine zipper protein 18